Input

>sp|Q8XCV3|5DNU_ECO57 5'-deoxynucleotidase YfbR
MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
VFVPSFHLSLDEISQDSPL
>tr|B8ZY94|B8ZY94_ECOLX T3SS secreted effector Map
MFSPTAMVGRALAQAVTQTLRPAVTKAATQAGMGANGMRFAAMQSNLMINHGKLTNQLLQ
AVAKQTGSSDTQQWFKQEQITFLSRTVNKTVDDYCMSNNSVINKETKFRIFKAVESAIQQ
PLDMNCAQSSIGHFLQSNKYFNQKVDEQCGKGVDPITRFNTQTKMIELVSREIFEQNFNT
AKVSDIKALTQRAIAENVQDTRL


Users can submit one or more FASTA-formatted protein sequences as input.
Protein sequences must be in one-letter amino acid code (not case-sensitive).
Allowed amino acids are: ACDEFGHIKLMNPQRSTVWY and X (unknown).

Output

Protein ID Score Type III Effector Annotation Type
sp|Q8XCV3|5DNU_ECO57 99 NO SVM
tr|B8ZY94|B8ZY94_ECOLX 100 YES PSI-BLAST

For each protein the results consist of:
 (1) protein identifier as provided by the user
 (2) reliability score of a prediction on a 0-100 scale with 100 being the most confident prediction
 (3) 'yes' or 'no' stating if a protein is predicted to be a type III effector or not
 (4) method used for the prediction
Mouse click on 'PSI-BLAST' leads to the pairwise sequence alignment of the query
sequence to its best PSI-BLAST hit (i.e. the one with the maximum identity).

Sample output if a PSI-BLAST homolog is available

Protein ID Score Type III Effector Annotation Type
tr|B8ZY94|B8ZY94_ECOLX 100 YES PSI-BLAST

Best PSI-BLAST hit to:

>B8ZY94

Identities = 203/203 (100%), Positives = 203/203 (100%)
Query: 1   MFSPTAMVGRALAQAVTQTLRPAVTKAATQAGMGANGMRFAAMQSNLMINHGKLTNQLLQ 60
           MFSPTAMVGRALAQAVTQTLRPAVTKAATQAGMGANGMRFAAMQSNLMINHGKLTNQLLQ
Sbjct: 1   MFSPTAMVGRALAQAVTQTLRPAVTKAATQAGMGANGMRFAAMQSNLMINHGKLTNQLLQ 60

Query: 61  AVAKQTGSSDTQQWFKQEQITFLSRTVNKTVDDYCMSNNSVINKETKFRIFKAVESAIQQ 120
           AVAKQTGSSDTQQWFKQEQITFLSRTVNKTVDDYCMSNNSVINKETKFRIFKAVESAIQQ
Sbjct: 61  AVAKQTGSSDTQQWFKQEQITFLSRTVNKTVDDYCMSNNSVINKETKFRIFKAVESAIQQ 120

Query: 121 PLDMNCAQSSIGHFLQSNKYFNQKVDEQCGKGVDPITRFNTQTKMIELVSREIFEQNFNT 180
           PLDMNCAQSSIGHFLQSNKYFNQKVDEQCGKGVDPITRFNTQTKMIELVSREIFEQNFNT
Sbjct: 121 PLDMNCAQSSIGHFLQSNKYFNQKVDEQCGKGVDPITRFNTQTKMIELVSREIFEQNFNT 180

Query: 181 AKVSDIKALTQRAIAENVQDTRL 203
           AKVSDIKALTQRAIAENVQDTRL
Sbjct: 181 AKVSDIKALTQRAIAENVQDTRL 203
Shown is the PSI-BLAST alignment with the best hit leading to the final prediction.
Id of the best hit is linked to its UniProtKB entry.


Copyright © 2017 BROMBERGLAB all rights reserved.