ID   MIX_00304
AC   304
CL   MIX
DT   23-MAY-2003 (Rel. 1.0, created)
UD   05-JUL-2004 (chop and predictions added)
UD   12-JUL-2004 (NMTS-homology added)
NA   Estrogen receptor
NA   ER
NA   Estradiol receptor
NA   ER-alpha
GN   ESR1
GN   NR3A1
GN   ESR
GN   ESTR
OS   Rattus norvegicus (Rat)
CT   liver, prostate cell, uterine cell
P1   6430682 (1984), 6643487 (1983)
P2   2004602 (1991), 2318161 (1990), 3186693 (1988), 6430682 (1984), 6643487 (1983), 12351687 (2002), 11682483 (2001), 11964215 (2002), 12123286 (2002)
SP   ESR1_RAT, P06211
KW   DNA-binding, Nuclear protein, Phosphorylation, Receptor, Steroid-binding, Transcription regulation, Zinc-finger
FN   Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. 
GB   CAA68287.1, CAA43411.1
SS   SWISSPROT/TrEMBL
SI   600 AA; 66953 Da; calculated pI: 8.30
SQ   MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPAVFNYPEGAAYEFNAAAAAAAAGASAPVYGQSSITYGPGSEAAAFGANSLGAFPQLNSVSPSPLMLLHPPPHVSPFLHPHGHQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSSEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGTSGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPLIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKINDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQSQLTTTSSTSAHSLQTYYIPPEAEGFPNTI
SE   LEEEELLLLLLLHHHHLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLEEEEEELLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLLLLLHHHHHHHHHHHHHHHLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHHHHHHHLLLLLLLLHHHHHHHHHHHHHHHHHHHHHHHLLLLLLLEEELLLLEELLLLLLLLLLHHHHHHHHHHHHHHHHHLLLLLHHHHHHHHEEEELLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHHHHLLLLLLLHHHHHHHHHHHHHHHHHHLHHHHHHHEEEELLLLLLLHHHHHHHHHHLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
SA   bbbbbbbebbbibbbieiieeebiebbieebeeeeeeeeeebibeeeeebbbeibeebeeebeibbbeeibeeeieiibieieeeeiiiebeeeeeeeeeebibeeeeeebeeibieieeebbeibieeeeeieiiieeeeeeeieeeeieeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeibbbbbbbibbbibbbbbbbebbibbbiibbiebbibbbebeeibbbbiebieibbbbibiibbbbbbbiebbieeieiiiiiieieeeeeeeeeeeeeeeeeiieeeiiebeibbeeeeeebibbbiibeibbibbbebiieiibbeeeeeieibebibbbbbbibbiebbbbbbibbeibbibbibbbibbbbbbibbbbbbbbbbbbbibbeieeebbbbbibbbiieibibbebbbibbibbbibbeibiibibieeibbbbbbbbbbbbebbbbbieeieebeeieibiebbeebbebbiibbbeieeeieeieiibbibbbbbbbbiibbiebbebbbbbibebebibbibbbibbebbiiieeeeeeeeeeeeeeeeeeieeeeeeeebeeeeiiieeeeeieebb
HT   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
CO   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
NO   nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
NL   95
DO   #1; AA 1-186; homologue=PF02159.5(1-185); eval=9.2e-147; method=HMMER/Pfam_ls
DO   #2; AA 190-255; homologue=1gdc_1(2-67); eval=4e-21; method=BLAST/prism_trim
DO   #3; AA 256-311; homologue=NULL; eval=NULL; method=NULL
DO   #4; AA 312-394; homologue=1pq6D1(4-84); eval=0.007; method=BLAST/prism_trim
DO   #5; AA 395-548; homologue=PF00104.14(1-200); eval=1.8e-12; method=HMMER/Pfam_ls
DO   #6; AA 549-600; homologue=NULL; eval=NULL; method=NULL
PT   MIX_00302 (hssp=16.64)
CC   this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
AT   188-343 (DO #2,#3,#4) (alignment)
NT   RYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGTSGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPLIYSEYDPSRPFS
//