ID   MIX_00027
AC   27
CL   MIX
DT   22-MAY-2003 (Rel. 1.0, created)
UD   05-JUL-2004 (chop and predictions added)
NA   Proliferating cell nuclear antigen
NA   PCNA
GN   PCNA
OS   Cricetulus griseus (Chinese hamster)
CT   CHO cell
P1   9729238 (1998), 11425231 (2001)
P2   11425231 (2001), 10022607 (1999), 9729238 (1998)
SP   PCNA_CRIGR, P57761
KW   DNA replication, DNA-binding, Nuclear protein
FN   This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand (By similarity). 
GB   AAG10077.1
SS   SWISSPROT/TrEMBL
SI   261 AA; 28762 Da; calculated pI: 4.57
SQ   MFEARLVQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSTDVPLVVEYKISDMGHLKYYLAPKIEDEEGS
SE   LLEEEELLHHHHHHHHHHHHHHHHHLEEEELLLLLEEEEELLLLEEEEEEEELLLLLLEEELLLLLEEEELHHHHHHHHHHLLLLLEEEEEELLLLLEEEEEEELLLLLLEEEEEEEEELLLLLLLLLLLLLLLEEEEELHHHHHHHHHHHHHLLLEEEEEELLLLEEEEEELLLLLEEEEEELLLLLLLLLLLEEEEELLLLEEEEHHHHHHHHHHLLLLLLEEEEEELLLLLEEEEEEELLLLEEEEEELLLLLLLLLL
SA   bbibibiebebbiebbebbeebbeebbbebieebbibbbbiebibbbbbbibieebbeibibeiebbbbbbbebbbebbebbeeeebbbbibeeeeeibbbbbebieeeibbebibibbibibeibebieeebibibibibeibbibbiebeebbebbbbbbieeibibibibebbebbbibieeieieeeeebbbbibeeebibbbbbibbiebbebbebbeibbbibbeebbbbbibibieibibbbbbbbibeeeeee
HT   ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
CO   ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
NO   ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
NL   0
DO   #1; AA 14-251; homologue=1iz4A1(13-236); eval=3e-14; method=BLAST/prism_trim
//