Input

>OR5L1_HUMAN Olfactory receptor 5L1 OS=Homo sapiens GN=OR5L1 PE=2 SV=1
MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMIALIQVSSRLHTPMY
FFLSHLSSVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCVVTEVFLLAVMAY
DRFVAICNPLLYTVTMSWKVRVELASCCYFCGTVCSLIHLCLALRIPFYRSNVINHFFCD
LPPVLSLACSDITVNETLLFLVATLNESVTIMIILTSYLLILTTILKMGSAEGRHKAFST
CASHLTAITVFHGTVLSIYCRPSSGNSGDADKVATVFYTVVIPMLNSVIYSLRNKDVKEA
LRKVMGSKIHS
>E9PX37_MOUSE Protein Krtap27-1 OS=Mus musculus GN=Krtap27-1 PE=4 SV=1
MLHSHCQSFRSLGKAPSLSSITHNSNPKSFEDGIVLPSSCHRRTWLLDNFQETYSETSTC
QPANCGQNQCKVDPCVQSSQNSRAEQTICSNSKTCERTREISPAVPESASQTCQSRNYKQ
VGFVAQSYQPASYMAKCCPLKSTAFESCQTLEFESSPCCSQVSESRSCNSSSSIVSGLHL
VESSNTYEPTCCVTGGSQVPSK


Users can submit one or more FASTA-formatted protein sequences as input.
Protein sequences must be in one-letter amino acid code (not case-sensitive). The allowed amino acids are: ACDEFGHIKLMNPQRSTVWY and X (unknown).
It is important to choose the right organism domain for query protein sequences.
LocTree3 predicts 18 localization classes or eukaryotic proteins, 6 classes for bacterial proteins and 3 classes for archaeal proteins.

Output

Protein ID Score Expected Accuracy Localization Class Gene Ontology Terms Annotation Type
OR5L1_HUMAN 100 99% plasma membrane integral to membrane GO:0016021(IEA); plasma membrane GO:0005886(TAS); PSI-BLAST
E9PX37_MOUSE 99 98% secreted extracellular region GO:0005576; LocTree2

For each protein the results consist of:
 (1) protein identifier as provided by the user
 (2) reliability score of a prediction on a 0-100 scale with 100 being the most confident prediction
 (3) the expected accuracy of this prediction. This estimatimation is based on the average accuracy of predictions above this score in our cross-validation
 (4) predicted localization class (one of 18 classes for Eukarya, 6 for Bacteria and 3 for Archaea)
 (5) GO terms and GO identifiers matching the predicted class; the GO terms' evidence code is set in parentheses
 (6) method used for the prediction.
Mouse click on Protein ID leads to the detailed description of a prediction (see next sections).
 Mouse click on a GO term leads to its corresponding entry in the Gene Ontology Database .

Sample output if annotation or close homolog available (PSI-BLAST)

Protein ID Score Expected Accuracy Localization Class Gene Ontology Terms Annotation Type
OR5L1_HUMAN 100 99% plasma membrane integral to membrane GO:0016021(IEA); plasma membrane GO:0005886(TAS); PSI-BLAST

Predicted Localization: plasma membrane
Localization prediction
>OR5L1_HUMAN
Identities = 311/311 (100%), Positives = 311/311 (100%)
Query: 1   MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMIALIQVSSRLHTPMY 60
           MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMIALIQVSSRLHTPMY
Sbjct: 1   MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMIALIQVSSRLHTPMY 60

Query: 61  FFLSHLSSVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCVVTEVFLLAVMAY 120
           FFLSHLSSVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCVVTEVFLLAVMAY
Sbjct: 61  FFLSHLSSVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCVVTEVFLLAVMAY 120

Query: 121 DRFVAICNPLLYTVTMSWKVRVELASCCYFCGTVCSLIHLCLALRIPFYRSNVINHFFCD 180
           DRFVAICNPLLYTVTMSWKVRVELASCCYFCGTVCSLIHLCLALRIPFYRSNVINHFFCD
Sbjct: 121 DRFVAICNPLLYTVTMSWKVRVELASCCYFCGTVCSLIHLCLALRIPFYRSNVINHFFCD 180

Query: 181 LPPVLSLACSDITVNETLLFLVATLNESVTIMIILTSYLLILTTILKMGSAEGRHKAFST 240
           LPPVLSLACSDITVNETLLFLVATLNESVTIMIILTSYLLILTTILKMGSAEGRHKAFST
Sbjct: 181 LPPVLSLACSDITVNETLLFLVATLNESVTIMIILTSYLLILTTILKMGSAEGRHKAFST 240

Query: 241 CASHLTAITVFHGTVLSIYCRPSSGNSGDADKVATVFYTVVIPMLNSVIYSLRNKDVKEA 300
           CASHLTAITVFHGTVLSIYCRPSSGNSGDADKVATVFYTVVIPMLNSVIYSLRNKDVKEA
Sbjct: 241 CASHLTAITVFHGTVLSIYCRPSSGNSGDADKVATVFYTVVIPMLNSVIYSLRNKDVKEA 300

Query: 301 LRKVMGSKIHS 311
           LRKVMGSKIHS
Sbjct: 301 LRKVMGSKIHS 311
The detailed description contains:
 (1) schematic representation of the predicted localization in the cell
 (2) PSI-BLAST alignment with the best hit leading to the final prediction. Id of the best hit is linked to its Swiss-Prot entry.

Sample output if no annotation or close homolog available (LocTree2)

Protein ID Score Expected Accuracy Localization Class Gene Ontology Terms Annotation Type
E9PX37_MOUSE 99 98% secreted extracellular region GO:0005576; LocTree2

Predicted Localization: secreted
Localization prediction
>E9PX37_MOUSE
Localization prediction

The detailed description contains:
 (1) schematic representation of the predicted localization in the cell
 (2) visualization of the decisions leading to the prediction; the score is formed through the product of the reliabilities along the decision path

Copyright © 2016 ROSTLAB all rights reserved.