Domain

LocTree3 also
available through


LocTree2/3 reference


Visit us at




Eukaryota
Bacteria
Archaea
Enter protein amino acid sequences in FASTA format >OR5L1_HUMAN Olfactory receptor 5L1 OS=Homo sapiens GN=OR5L1 PE=2 SV=1
MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMIALIQVSSRLHTPMY
FFLSHLSSVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCVVTEVFLLAVMAY
DRFVAICNPLLYTVTMSWKVRVELASCCYFCGTVCSLIHLCLALRIPFYRSNVINHFFCD
LPPVLSLACSDITVNETLLFLVATLNESVTIMIILTSYLLILTTILKMGSAEGRHKAFST
CASHLTAITVFHGTVLSIYCRPSSGNSGDADKVATVFYTVVIPMLNSVIYSLRNKDVKEA
LRKVMGSKIHS
Due to long running times we recommend not to
submit more than 10000 sequences for eukaryotes.
For larger jobs you are welcome to contact us.
OPTIONAL: Email address
HELP Want to be notified once your job is processed?
Your Email address will not be stored or used
for any other purpose


Copyright © 2016 ROSTLAB all rights reserved.